Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tjp1 Rabbit Polyclonal Antibody (HRP)

Tjp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZO-1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

190kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brucella melitensis coat
EIAR Brucella melitensis coat 1 mL

Brucella melitensis coat

Sign In for Pricing
View Details
Phospho-Myt1 (Ser83) Antibody
MBS9600697-01 0.1 mL

Phospho-Myt1 (Ser83) Antibody

Sign In for Pricing
View Details
Phospho-Myt1 (Ser83) Antibody
MBS9600697-02 0.2 mL

Phospho-Myt1 (Ser83) Antibody

Sign In for Pricing
View Details
Phospho-Myt1 (Ser83) Antibody
MBS9600697-03 5x 0.2 mL

Phospho-Myt1 (Ser83) Antibody

Sign In for Pricing
View Details
Anti-F13A1 Antibody
STJ501101 100 µg

Anti-F13A1 Antibody

Sign In for Pricing
View Details
Canine Alpha 1, 4 N acetylglucosaminyltransferase (A4GNT) ELISA Kit
GTR10317803 96 Well

Canine Alpha 1, 4 N acetylglucosaminyltransferase (A4GNT) ELISA Kit

Sign In for Pricing
View Details