Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJC1 Rabbit Polyclonal Antibody (HRP)

GJC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CX45, GJA7

UniProt

P36383

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005488

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SARG (C1orf116) activation kit by CRISPRa
GA112369 1 Kit

Human SARG (C1orf116) activation kit by CRISPRa

Sign In for Pricing
View Details
Phospho-L-arginine Trisodium Salt
TRC-P354000-1MG 1 mg

Phospho-L-arginine Trisodium Salt

Sign In for Pricing
View Details
CJ-023423 Hydrochloride Salt, Hydrate
TRC-C535808-25MG 25 mg

CJ-023423 Hydrochloride Salt, Hydrate

Sign In for Pricing
View Details
Anti-CTLA-4 (9H10) In Vivo Antibody - Low Endotoxin
ICH1084-25mg 25 mg

Anti-CTLA-4 (9H10) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
MRPS22 (NM_020191) Human Recombinant Protein
TP303424M 100 µg

MRPS22 (NM_020191) Human Recombinant Protein

Sign In for Pricing
View Details
General Purpose Incubator BIGP-302
BIGP-302 1 Unit

General Purpose Incubator BIGP-302

Sign In for Pricing
View Details