Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT140 Rabbit Polyclonal Antibody (Biotin)

IFT140 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP80, MZSDS, SRTD9, WDTC2, gs114, c305C8.4, c380F5.1

UniProt

Q96RY7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IFT140

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

165kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PUS7L (NM_031292) Human Recombinant Protein
PROTQ9H0K6 20 µg

PUS7L (NM_031292) Human Recombinant Protein

Sign In for Pricing
View Details
CD162 Rabbit Polyclonal Antibody
orb6814-01 50 μL

CD162 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD162 Rabbit Polyclonal Antibody
orb6814-02 100 µL

CD162 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD162 Rabbit Polyclonal Antibody
orb6814-03 200 µL

CD162 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SGOL1 (SGOL1, SGO1, Shugoshin-like 1, hSgo1, Serologically defined breast cancer antigen NY-BR-85)
334095-01 50 µg

SGOL1 (SGOL1, SGO1, Shugoshin-like 1, hSgo1, Serologically defined breast cancer antigen NY-BR-85)

Sign In for Pricing
View Details
SGOL1 (SGOL1, SGO1, Shugoshin-like 1, hSgo1, Serologically defined breast cancer antigen NY-BR-85)
334095-02 100 µg

SGOL1 (SGOL1, SGO1, Shugoshin-like 1, hSgo1, Serologically defined breast cancer antigen NY-BR-85)

Sign In for Pricing
View Details