Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJC2 Rabbit Polyclonal Antibody (HRP)

GJC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cx47, HLD2, GJA12, SPG44, CX46.6, LMPH1C, LMPHM3, PMLDAR

UniProt

Q5T442

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

IHC, WB

NCBI Accession Number

NP_065168

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody Pair
abx370222-01 5x 96 Tests

Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody Pair

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody Pair
abx370222-02 10x 96 Tests

Tumor Necrosis Factor Ligand Superfamily Member 11 / RANKL (TNFSF11) Antibody Pair

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF740 conjugate, 0.1mg/mL
BNC743019-500 1x 500 µL

CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CBLN3 Protein Vector (Human) (pPB-N-His)
PV067558 500 ng

CBLN3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1)
MBS643542-01 0.2 mL

BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1)

Sign In for Pricing
View Details
BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1)
MBS643542-02 5x 0.2 mL

BNC1, NT (BNC1, BNC, Zinc finger protein basonuclin-1)

Sign In for Pricing
View Details