Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA9 Rabbit Polyclonal Antibody (HRP)

GJA9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CX58, CX59, GJA10

UniProt

P57773

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJA9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_110399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Slc9c1 Pre-designed siRNA Set A
SI113332A 1 Each

Mouse Slc9c1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CBFB (NM_022845) Human Over-expression Lysate
LH11810V 100 µg

CBFB (NM_022845) Human Over-expression Lysate

Sign In for Pricing
View Details
Pipette Tip, 300ul Rainin LTS tip, rack, sterile, low retention,96pcs/rack, 50racks/case
PLAPGRT300RLSA 4750 Pieces/Case:95 Pieces/ PACKS:50 PACKS/CASE

Pipette Tip, 300ul Rainin LTS tip, rack, sterile, low retention,96pcs/rack, 50racks/case

Sign In for Pricing
View Details
Recombinant Human ING3 (FLAG)
BP3808-50ug 50 µg

Recombinant Human ING3 (FLAG)

Sign In for Pricing
View Details
TFCP2L1 Protein Vector (Mouse) (pPB-N-His)
PV237783 500 ng

TFCP2L1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
L-Alanyl-L-1-aminoethylphosphonic acid
sc-257647 250 mg

L-Alanyl-L-1-aminoethylphosphonic acid

Sign In for Pricing
View Details