Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA9 Rabbit Polyclonal Antibody (HRP)

GJA9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CX58, CX59, GJA10

UniProt

P57773

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJA9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_110399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CEACAM6/CD66c Antibody (01) [mFluor Violet 450 SE]
NBP2-89670MFV450 0.1 mL

Rabbit Monoclonal CEACAM6/CD66c Antibody (01) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
MRP-L18 shRNA Plasmid (m)
sc-149586-SH 20 µg

MRP-L18 shRNA Plasmid (m)

Sign In for Pricing
View Details
Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit
MBS2802544-01 48 Tests

Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit

Sign In for Pricing
View Details
Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit
MBS2802544-02 96 Tests

Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit

Sign In for Pricing
View Details
Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit
MBS2802544-03 5x 96 Tests

Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit

Sign In for Pricing
View Details
Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit
MBS2802544-04 10x 96 Tests

Donkey Regenerating Islet Derived Protein 4 (REG4) ELISA Kit

Sign In for Pricing
View Details