Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJA9 Rabbit Polyclonal Antibody (Biotin)

GJA9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CX58, CX59, GJA10

UniProt

P57773

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJA9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_110399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOM1L1 Protein Vector (Human) (pPM-C-HA)
47281021 500 ng

TOM1L1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
48 Spin Tips Assembled Box
083.MSP16.20X 80 Boxes/Carton

48 Spin Tips Assembled Box

Sign In for Pricing
View Details
Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit
MBS7259952-01 48 Well

Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit

Sign In for Pricing
View Details
Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit
MBS7259952-02 96 Well

Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit

Sign In for Pricing
View Details
Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit
MBS7259952-03 5x 96 Well

Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit

Sign In for Pricing
View Details
Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit
MBS7259952-04 10x 96 Well

Goat Serine/Threonine Protein Phosphatase 2A Catalytic Subunit Alpha Isoform (PPP2CA) ELISA Kit

Sign In for Pricing
View Details