Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RAB44 Pre-designed siRNA Set A
SI013311A 1 Each

Human RAB44 Pre-designed siRNA Set A

Sign In for Pricing
View Details
CA10 (Carbonic Anhydrase-related Protein 10, Carbonic Anhydrase-related Protein X, CA-RP X, CARP X, Cerebral Protein 15, UNQ533/PRO1076, hucep-15) APC
MBS6135604-01 0.1 mL

CA10 (Carbonic Anhydrase-related Protein 10, Carbonic Anhydrase-related Protein X, CA-RP X, CARP X, Cerebral Protein 15, UNQ533/PRO1076, hucep-15) APC

Sign In for Pricing
View Details
CA10 (Carbonic Anhydrase-related Protein 10, Carbonic Anhydrase-related Protein X, CA-RP X, CARP X, Cerebral Protein 15, UNQ533/PRO1076, hucep-15) APC
MBS6135604-02 5x 0.1 mL

CA10 (Carbonic Anhydrase-related Protein 10, Carbonic Anhydrase-related Protein X, CA-RP X, CARP X, Cerebral Protein 15, UNQ533/PRO1076, hucep-15) APC

Sign In for Pricing
View Details
Rat Interleukin-33 (IL-33) AssayLite™ Antibody (PerCP Conjugate)
32099-05171 5x 30 µg

Rat Interleukin-33 (IL-33) AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
Catenin Beta 1 (CTNNb1) Recombinant, Human
153908-01 10 µg

Catenin Beta 1 (CTNNb1) Recombinant, Human

Sign In for Pricing
View Details
Catenin Beta 1 (CTNNb1) Recombinant, Human
153908-02 50 µg

Catenin Beta 1 (CTNNb1) Recombinant, Human

Sign In for Pricing
View Details