Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIA kit for Human CCKAR (Cholecystokinin A Receptor)
E-CL-H0525 96 Tests

CLIA kit for Human CCKAR (Cholecystokinin A Receptor)

Sign In for Pricing
View Details
ISK7 rabbit pAb
UB-GEN-12385 100 µL

ISK7 rabbit pAb

Sign In for Pricing
View Details
Ethyl (S) -3-hydroxybutanoate
MF-0109107-01 10 g

Ethyl (S) -3-hydroxybutanoate

Sign In for Pricing
View Details
Ethyl (S) -3-hydroxybutanoate
MF-0109107-02 5 g

Ethyl (S) -3-hydroxybutanoate

Sign In for Pricing
View Details
Ethyl (S) -3-hydroxybutanoate
MF-0109107-03 50 g

Ethyl (S) -3-hydroxybutanoate

Sign In for Pricing
View Details
Recombinant Mouse Semaphorin 3D Fc Chimera Protein
9386-S3-025 25 µg

Recombinant Mouse Semaphorin 3D Fc Chimera Protein

Sign In for Pricing
View Details