Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kobophenol A
MBS5787209 Inquire

Kobophenol A

Sign In for Pricing
View Details
Bis(2,2'-bipyridine-KappaN1,KappaN1')[[2,2'-bipyridine]-4,4'-dicarboxylato(2-)-KappaN1,KappaN1']ruthenium Hexafluorophosphate
TRC-B534845-10MG 10 mg

Bis(2,2'-bipyridine-KappaN1,KappaN1')[[2,2'-bipyridine]-4,4'-dicarboxylato(2-)-KappaN1,KappaN1']ruthenium Hexafluorophosphate

Sign In for Pricing
View Details
Myosin IF (MYO1F) Antibody
abx375606 100 µg

Myosin IF (MYO1F) Antibody

Sign In for Pricing
View Details
OR5AS1, CT (OR5AS1, Olfactory receptor 5AS1, Olfactory receptor OR11-168) (APC)
MBS6329197-01 0.2 mL

OR5AS1, CT (OR5AS1, Olfactory receptor 5AS1, Olfactory receptor OR11-168) (APC)

Sign In for Pricing
View Details
OR5AS1, CT (OR5AS1, Olfactory receptor 5AS1, Olfactory receptor OR11-168) (APC)
MBS6329197-02 5x 0.2 mL

OR5AS1, CT (OR5AS1, Olfactory receptor 5AS1, Olfactory receptor OR11-168) (APC)

Sign In for Pricing
View Details
Retreg1 (NM_001277315) Mouse Untagged Clone
MC227247 10 µg

Retreg1 (NM_001277315) Mouse Untagged Clone

Sign In for Pricing
View Details