Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RX4 3'UTR GFP Stable Cell Line
TU067249 1.0 mL

P2RX4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Fehling's Solution A
40220109-1 500 mL

Fehling's Solution A

Sign In for Pricing
View Details
Recombinant Pig Fatty Acid Binding Protein 5 (FABP5)
RPU54530-01 50 µg

Recombinant Pig Fatty Acid Binding Protein 5 (FABP5)

Sign In for Pricing
View Details
Recombinant Pig Fatty Acid Binding Protein 5 (FABP5)
RPU54530-02 100 µg

Recombinant Pig Fatty Acid Binding Protein 5 (FABP5)

Sign In for Pricing
View Details
Recombinant Pig Fatty Acid Binding Protein 5 (FABP5)
RPU54530-03 1 mg

Recombinant Pig Fatty Acid Binding Protein 5 (FABP5)

Sign In for Pricing
View Details
N-Acetyl-D-mannosamine (Standard)
HY-128850R-01 10 mg

N-Acetyl-D-mannosamine (Standard)

Sign In for Pricing
View Details