Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine apoprotein A5 (ApoA-5) ELISA Kit
YP-W80748-01 48 Tests

Porcine apoprotein A5 (ApoA-5) ELISA Kit

Sign In for Pricing
View Details
Porcine apoprotein A5 (ApoA-5) ELISA Kit
YP-W80748-02 96 Tests

Porcine apoprotein A5 (ApoA-5) ELISA Kit

Sign In for Pricing
View Details
PH Domain And Leucine Rich Repeat Protein Phosphatase 1 (PHLPP) Antibody
abx236398 100 µg

PH Domain And Leucine Rich Repeat Protein Phosphatase 1 (PHLPP) Antibody

Sign In for Pricing
View Details
SEP-363856 HCl 500mg
A22555-500 500 mg

SEP-363856 HCl 500mg

Sign In for Pricing
View Details
Lentiviral human KARS1 sgRNA gene knockout kit - Lentiviral human KARS1 sgRNA gene knockout kit (100)
GTR15366148 1 Vial

Lentiviral human KARS1 sgRNA gene knockout kit - Lentiviral human KARS1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
GLTPD1 (1-214, His-tag) Human Protein
AR51650PU-S 20 µg

GLTPD1 (1-214, His-tag) Human Protein

Sign In for Pricing
View Details