Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRP Latex Kit with Control
LTXCRPON-050 50 Tests

CRP Latex Kit with Control

Sign In for Pricing
View Details
Human Heat Shock Protein 27 (HSP27) AssayMax™ ELISA Kit
EH5001-1 96 Well

Human Heat Shock Protein 27 (HSP27) AssayMax™ ELISA Kit

Sign In for Pricing
View Details
PHC3 Double Nickase Plasmid (h)
sc-406576-NIC 20 µg

PHC3 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Tm2d1 Mouse Gene Knockout Kit (CRISPR)
KN517636 1 Kit

Tm2d1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSP22 Monoclonal Antibody, PE Conjugated
bsm-33241M-PE 100 µL

HSP22 Monoclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
saCas9 Nuclease AAV Virus (AAV9)
K216 5x 100 µL

saCas9 Nuclease AAV Virus (AAV9)

Sign In for Pricing
View Details