Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Corona Virus (CoV) ELISA Kit
CK-bio-25676-01 48 Tests

Bovine Corona Virus (CoV) ELISA Kit

Sign In for Pricing
View Details
Bovine Corona Virus (CoV) ELISA Kit
CK-bio-25676-02 96 Tests

Bovine Corona Virus (CoV) ELISA Kit

Sign In for Pricing
View Details
Olr1620 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV630121 1.0 µg DNA

Olr1620 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PCMV-KLHL20-3xFLAG-Neo Plasmid
PVT69175 2 µg

PCMV-KLHL20-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
Mouse 9530027J09Rik activation kit by CRISPRa
GA219397 1 Kit

Mouse 9530027J09Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Atp5sl 3'UTR Luciferase Stable Cell Line
TU102337 1.0 mL

Atp5sl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details