Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2/CD85d/ILT-4, Human (HEK293, His)

The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lilrb2-cd85d-ilt-4-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRH

Molecular Formula

10288 (Gene_ID) AAH36827.1 (Q22-H458) (Accession)

Molecular Weight

58-75 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANBB Protein Vector (Human) (pPB-C-His)
PV093054 500 ng

MANBB Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei lldD Protein (aa 1-396)
VAng-Lsx09831-500gEcoli 500 µg (E. coli)

Recombinant Shigella Sonnei lldD Protein (aa 1-396)

Sign In for Pricing
View Details
TAF4 CRISPR Knock Out 293T Cell Line (Human)
46082141 1x 10^6 Cells / 1.0 mL

TAF4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
FOXL3-OT1 Human Gene Knockout Kit (CRISPR)
KN431080 1 Kit

FOXL3-OT1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HHC2 3'UTR GFP Stable Cell Line
TU059758 1.0 mL

HHC2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Clostridium botulinum botA/BoNT Antibody
E55A13531 100 µg

Clostridium botulinum botA/BoNT Antibody

Sign In for Pricing
View Details