Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJC1 Rabbit Polyclonal Antibody (HRP)

GJC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GJC1, GJA11, CX31.9, Cx30.2

UniProt

Q6ZUW6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GJC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dysferlin interacting protein 1 (PPP1R27) (NM_001007533) Human Recombinant Protein
TP310807M 100 µg

Dysferlin interacting protein 1 (PPP1R27) (NM_001007533) Human Recombinant Protein

Sign In for Pricing
View Details
PDE4 (PDE4B) (Center) Rabbit Polyclonal Antibody
AP53236PU-N 400 µL

PDE4 (PDE4B) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EAAC1 Antibody: ATTO 488
SMC-406D-A488 100 µg

EAAC1 Antibody: ATTO 488

Sign In for Pricing
View Details
FGR Mouse Monoclonal Antibody [Clone ID: 6G2]
AM06312SU-N 100 µL

FGR Mouse Monoclonal Antibody [Clone ID: 6G2]

Sign In for Pricing
View Details
Carboxypeptidase Z (CPZ) (N-term) Rabbit Polyclonal Antibody
AP17239PU-N 400 µL

Carboxypeptidase Z (CPZ) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559605 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details