Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJC1 Rabbit Polyclonal Antibody (HRP)

GJC1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GJC1, GJA11, CX31.9, Cx30.2

UniProt

Q6ZUW6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GJC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZW10 (NM_004724) Human Recombinant Protein
TP313297L 1 mg

ZW10 (NM_004724) Human Recombinant Protein

Sign In for Pricing
View Details
Alpha-Epoxyabiraterone Acetate
TRC-E589090-10MG 10 mg

Alpha-Epoxyabiraterone Acetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS506570 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)
PKSH030296-01 100 µg

Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)
PKSH030296-02 1 mg

Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Human CD197/CCR7 Antibody[G043H7]
E-AB-F1159S-01 20 Tests

Elab Fluor® Red 780 Anti-Human CD197/CCR7 Antibody[G043H7]

Sign In for Pricing
View Details