Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJD3 Rabbit Polyclonal Antibody (HRP)

GJD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GJC1, GJA11, CX31.9, Cx30.2

UniProt

Q8N144

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLLSALLSVAELGHLLWKGRPRAGERDNRCNRAHEEAQKLLPPPPPPPPP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689343

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifnb1 (NM_010510) Mouse Recombinant Protein
TP723785 10 µg

Ifnb1 (NM_010510) Mouse Recombinant Protein

Sign In for Pricing
View Details
Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 20nm
GP-1102-20 1 mL

Colloidal Gold Conjugated Succinyl Canavalia ensiformis Lectin (Jackbean) -Succinyl Con A-, 1mL 20nm

Sign In for Pricing
View Details
MMP9 (Matrix Metalloproteinase 9) (2C3), 0.2mg/mL
BNUB1764-100 1x 100 µL

MMP9 (Matrix Metalloproteinase 9) (2C3), 0.2mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL
BNC550020-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human TH/Tyrosine Hydroxylase Protein (His Tag)
PKSH031490 50 µg

Recombinant Human TH/Tyrosine Hydroxylase Protein (His Tag)

Sign In for Pricing
View Details
Mini Sample Mouse PF4 (Platelet Factor 4) ELISA Kit
E-MSEL-M0116-01 24 Tests

Mini Sample Mouse PF4 (Platelet Factor 4) ELISA Kit

Sign In for Pricing
View Details