Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJB4 Rabbit Polyclonal Antibody (HRP)

GJB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EKV, EKVP2, CX30.3

UniProt

Q9NTQ9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_694944

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHHADH Antibody (C-term) Blocking Peptide
MBS9227756-01 0.5 mg

EHHADH Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
EHHADH Antibody (C-term) Blocking Peptide
MBS9227756-02 5x 0.5 mg

EHHADH Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
RAB20 (NM_017817) Human 3' UTR Clone
SC208204 10 µg

RAB20 (NM_017817) Human 3' UTR Clone

Sign In for Pricing
View Details
TOM1L2 3'UTR GFP Stable Cell Line
TU076090 1.0 mL

TOM1L2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Peanut Cake Powder for Fermentation
FA0150 500 g

Peanut Cake Powder for Fermentation

Sign In for Pricing
View Details
KCNK17 Polyclonal Antibody
orb1419175 100 µL

KCNK17 Polyclonal Antibody

Sign In for Pricing
View Details