Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJB4 Rabbit Polyclonal Antibody (Biotin)

GJB4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EKV, EKVP2, CX30.3

UniProt

Q9NTQ9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GJB4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_694944

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S232 Protein Vector (Human) (pPB-N-His)
PV116507 500 ng

RN5S232 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rabbit Polyclonal KPNA7 Antibody [Alexa Fluor 750]
NBP2-81730AF750 0.1 mL

Rabbit Polyclonal KPNA7 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Olr304 (NM_001001039) Rat Tagged ORF Clone
RR213168 10 µg

Olr304 (NM_001001039) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human Cyclin E2 MAb (Clone 718916)
MAB7444 100 µg

Human Cyclin E2 MAb (Clone 718916)

Sign In for Pricing
View Details
Mouse Monoclonal S100 calcium binding protein A14 Antibody (S100A14/7402) [Janelia Fluor 646]
NBP3-21129JF646 0.1 mL

Mouse Monoclonal S100 calcium binding protein A14 Antibody (S100A14/7402) [Janelia Fluor 646]

Sign In for Pricing
View Details
PAS1C1 (LMNTD1) (NM_001145729) Human Untagged Clone
SC326565 10 µg

PAS1C1 (LMNTD1) (NM_001145729) Human Untagged Clone

Sign In for Pricing
View Details