Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJE1 Rabbit Polyclonal Antibody (FITC)

GJE1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CX29, GJE1, CX30.2, CX31.3

UniProt

Q8NFK1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GJE1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_853516

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF594 conjugate, 0.1mg/mL
BNC943134-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3134R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carburetor Ultrasonic BULC-605
BULC-605 1 Unit

Carburetor Ultrasonic BULC-605

Sign In for Pricing
View Details
Human MUC5B (Mucin 5 Subtype B) ELISA Kit
E-EL-H2280-01 24 Tests

Human MUC5B (Mucin 5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Human MUC5B (Mucin 5 Subtype B) ELISA Kit
E-EL-H2280-02 48 Tests

Human MUC5B (Mucin 5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
Human MUC5B (Mucin 5 Subtype B) ELISA Kit
E-EL-H2280-03 96 Tests

Human MUC5B (Mucin 5 Subtype B) ELISA Kit

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF405L conjugate, 0.1mg/mL
BNC062600-100 1x 100 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF405L conjugate, 0.1mg/mL

Sign In for Pricing
View Details