Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Rabbit Polyclonal Antibody (FITC)

MCM3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_002379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnfsf13b ORF Vector (Rat) (pORF)
47226016 1.0 µg DNA

Tnfsf13b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal SMNDC1 Antibody (PCRP-SMNDC1-1A9) [Alexa Fluor 750]
NBP3-08232AF750 100 µL

Mouse Monoclonal SMNDC1 Antibody (PCRP-SMNDC1-1A9) [Alexa Fluor 750]

Sign In for Pricing
View Details
S100A12 Recombinant Protein
OPCD00521-10UG 10 µg

S100A12 Recombinant Protein

Sign In for Pricing
View Details
Gads Lentiviral Activation Particles (h2)
sc-402831-LAC-2 200 µL

Gads Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Humanin Rabbit Polyclonal Antibody (PE)
orb498894 100 µL

Humanin Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SLC10A5 Antibody - C-terminal region : HRP (ARP43773_T100-HRP)
ARP43773_T100-HRP 100 µL

SLC10A5 Antibody - C-terminal region : HRP (ARP43773_T100-HRP)

Sign In for Pricing
View Details