Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Rabbit Polyclonal Antibody (FITC)

MCM3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_002379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)
MBS2089735-01 5x 96 Tests

Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)
MBS2089735-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)
MBS2089735-03 10x 96 Tests

Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)
MBS2089735-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Vascular Endothelial Growth Factor A (VEGFA) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
GRIK3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV689258 1.0 µg DNA

GRIK3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Bovine Alpha-1-Antichymotrypsin (alpha1ACT) ELISA Kit
MBS2608710-01 48 Well

Bovine Alpha-1-Antichymotrypsin (alpha1ACT) ELISA Kit

Sign In for Pricing
View Details