Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Rabbit Polyclonal Antibody (Biotin)

MCM3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

IHC, WB

NCBI Accession Number

NP_002379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maohuoside B
HY-115689 1 Each

Maohuoside B

Sign In for Pricing
View Details
Human MBTPS1 Protein Lysate
MBS8415031-01 0.02 mg

Human MBTPS1 Protein Lysate

Sign In for Pricing
View Details
Human MBTPS1 Protein Lysate
MBS8415031-02 5x 0.02 mg

Human MBTPS1 Protein Lysate

Sign In for Pricing
View Details
MASP1 Conjugated Antibody
C43034 100 µL

MASP1 Conjugated Antibody

Sign In for Pricing
View Details
RUVBL2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61542R-BF555-01 20 µL

RUVBL2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
RUVBL2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61542R-BF555-02 100 µL

RUVBL2 Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details