Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Rabbit Polyclonal Antibody (HRP)

MCM3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

UniProt

P25205

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CMKLR1 Antibody
GWB-6E9949 0.05 mg

CMKLR1 Antibody

Sign In for Pricing
View Details
Lentiviral human MYH1 shRNA (UAS) - Lentiviral human MYH1 shRNA (UAS, iRFP) (25)
GTR15328121 1 Vial

Lentiviral human MYH1 shRNA (UAS) - Lentiviral human MYH1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit
MBS9394813-01 48 Well

Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit

Sign In for Pricing
View Details
Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit
MBS9394813-02 96 Well

Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit

Sign In for Pricing
View Details
Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit
MBS9394813-03 5x 96 Well

Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit

Sign In for Pricing
View Details
Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit
MBS9394813-04 10x 96 Well

Rat Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit

Sign In for Pricing
View Details