Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM3 Rabbit Polyclonal Antibody (Biotin)

MCM3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HCC5, P1.h, RLFB, P1-MCM3

UniProt

P25205

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

89kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002379

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RCC1 Rabbit Polyclonal Antibody (Fluoro488)
orb3109878 100 µg

RCC1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF, p8, Protein S100-A8, Urinary Stone Protein Band A) (MaxLight 650)
132931-ML650 100 µL

S100A8 (S100 Calcium Binding Protein A8, 60B8AG, Calgranulin-A, CAGA, CGLA, Calprotectin L1L Subunit, CP-10, Cystic Fibrosis Antigen, CFAG, L1Ag, Leukocyte L1 Complex Light Chain, MA387, MIF, Migration Inhibitory Factor-related Protein 8, MRP8, MRP-8, NIF, p8, Protein S100-A8, Urinary Stone Protein Band A) (MaxLight 650)

Sign In for Pricing
View Details
MET Protein (C-cleavage, Cynomolgus, Rhesus)
P526786 100 µg

MET Protein (C-cleavage, Cynomolgus, Rhesus)

Sign In for Pricing
View Details
NOXRED1 Recombinant Protein (Human)
RP078570 100 µg

NOXRED1 Recombinant Protein (Human)

Sign In for Pricing
View Details
THOC6 Rabbit Polyclonal Antibody (Biotin)
orb2114437 100 µL

THOC6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rat Slc8a1 Pre-designed siRNA Set B
SI213257B 1 Each

Rat Slc8a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details