Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM2 Rabbit Polyclonal Antibody (HRP)

MCM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BM28, CCNL1, CDCL1, cdc19, DFNA70, D3S3194, MITOTIN

UniProt

P49736

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tafazzin/TAZ Antibody Picoband®, HRP Conjugate
A00933-HRP 100 µg/Vial

Anti-Tafazzin/TAZ Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Micafungin sodium - Bio-X TM
BM164667 10 mg

Micafungin sodium - Bio-X TM

Sign In for Pricing
View Details
p21 Cip1 Colorimetric Cell-Based ELISA Kit
MBS9500439-01 1 Kit

p21 Cip1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
p21 Cip1 Colorimetric Cell-Based ELISA Kit
MBS9500439-02 5x 1 Kit

p21 Cip1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Fucosyl-GM1 Human Monoclonal Antibody
orb2976134-01 100 µg

Fucosyl-GM1 Human Monoclonal Antibody

Sign In for Pricing
View Details
Fucosyl-GM1 Human Monoclonal Antibody
orb2976134-02 1 mg

Fucosyl-GM1 Human Monoclonal Antibody

Sign In for Pricing
View Details