Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM4 Rabbit Polyclonal Antibody (HRP)

MCM4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NKCD, CDC21, CDC54, IMD54, NKGCD, hCdc21, P1-CDC21

UniProt

P33991

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005905

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Desmuslin (DMN) ELISA Kit
MBS9359161 Inquire

Donkey Desmuslin (DMN) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (SPM570) [Janelia Fluor 549]
NBP2-34804JF549 0.1 mL

Mouse Monoclonal CD45 Antibody (SPM570) [Janelia Fluor 549]

Sign In for Pricing
View Details
DDIT4 Rabbit pAb, PerCP-Cy7 conjugated
orb2890937 100 µL

DDIT4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human CD355/CRTAM mAb
A24819-01 100 Tests

ABflo® 647 Rabbit anti-Human CD355/CRTAM mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human CD355/CRTAM mAb
A24819-02 50 Tests

ABflo® 647 Rabbit anti-Human CD355/CRTAM mAb

Sign In for Pricing
View Details
ABflo® 647 Rabbit anti-Human CD355/CRTAM mAb
A24819-03 200 Tests

ABflo® 647 Rabbit anti-Human CD355/CRTAM mAb

Sign In for Pricing
View Details