Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM6 Rabbit Polyclonal Antibody (Biotin)

MCM6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mis5, P105MCM, MCG40308

UniProt

Q14566

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MCM6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NELFE Rabbit Polyclonal Antibody
orb1743879 100 µg

NELFE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (Biotin)
125348-Biotin 100 µL

CRMP1 (Dihydropyrimidinase-related Protein 1, DRP-1, Collapsin Response Mediator Protein 1, CRMP-1, Unc-33-like Phosphoprotein 3, ULIP-3, DPYSL1, ULIP3) (Biotin)

Sign In for Pricing
View Details
Actinomycetes Broth
RDM-ACTB-01 500 g

Actinomycetes Broth

Sign In for Pricing
View Details
Ethyl 5-bromo-3-methyl-1-benzothiophene-2-carboxylate
449408-01 100 mg

Ethyl 5-bromo-3-methyl-1-benzothiophene-2-carboxylate

Sign In for Pricing
View Details
Ethyl 5-bromo-3-methyl-1-benzothiophene-2-carboxylate
449408-02 250 mg

Ethyl 5-bromo-3-methyl-1-benzothiophene-2-carboxylate

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Aspartate ammonia-lyase (aspA)
MBS1368943-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa Aspartate ammonia-lyase (aspA)

Sign In for Pricing
View Details