Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM8 Rabbit Polyclonal Antibody (HRP)

MCM8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

POF10, C20orf154, dJ967N21.5

UniProt

Q9UJA3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MCM8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKD1 Protein Vector (Mouse) (pPM-C-HA)
PV219304 500 ng

PRKD1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HSPE1 Antibody - middle region : Biotin (ARP54651_P050-Biotin)
ARP54651_P050-Biotin 100 µL

HSPE1 Antibody - middle region : Biotin (ARP54651_P050-Biotin)

Sign In for Pricing
View Details
Recombinant Drosophila simulans Protein anon-73B1 (anon-73B1)
orb2935867-01 20 µg

Recombinant Drosophila simulans Protein anon-73B1 (anon-73B1)

Sign In for Pricing
View Details
Recombinant Drosophila simulans Protein anon-73B1 (anon-73B1)
orb2935867-02 100 µg

Recombinant Drosophila simulans Protein anon-73B1 (anon-73B1)

Sign In for Pricing
View Details
LZTS2 AAV Vector (Mouse) (CMV)
27873105 1 µg

LZTS2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Rabbit polyclonal anti-Sp3 transcription factor antibody
TA318993 100 µg

Rabbit polyclonal anti-Sp3 transcription factor antibody

Sign In for Pricing
View Details