Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM8 Rabbit Polyclonal Antibody (Biotin)

MCM8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

POF10, C20orf154, dJ967N21.5

UniProt

Q9UJA3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MCM8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

94kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115874

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig prosaposin (PSAP) ELISA Kit
MBS7249391-01 48 Strip Well

Guinea pig prosaposin (PSAP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig prosaposin (PSAP) ELISA Kit
MBS7249391-02 96 Strip Well

Guinea pig prosaposin (PSAP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig prosaposin (PSAP) ELISA Kit
MBS7249391-03 5x 96 Strip Well

Guinea pig prosaposin (PSAP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig prosaposin (PSAP) ELISA Kit
MBS7249391-04 10x 96 Strip Well

Guinea pig prosaposin (PSAP) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Zfyve19 shRNA (UAS) - Lentiviral mouseZfyve19 shRNA (UAS, GFP) (25)
GTR15288692 1 Vial

Lentiviral mouse Zfyve19 shRNA (UAS) - Lentiviral mouseZfyve19 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
DiscoveryProbe™ Tyrosine Kinase Inhibitor Library
L1028-.1 100 µL/Well (10 mM Solution) - 96 Well Racks With Screw Cap

DiscoveryProbe™ Tyrosine Kinase Inhibitor Library

Sign In for Pricing
View Details