Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM9 Rabbit Polyclonal Antibody (HRP)

MCM9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ODG4, MCMDC1, C6orf61, dJ329L24.1, dJ329L24.3

UniProt

B3KV41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MCM9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCK (NM_000788) Human Over-expression Lysate
LY400272 100 µg

DCK (NM_000788) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Recombinant Protein
TP304629M 100 µg

Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Recombinant Protein

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (ZL7-4), CF488A conjugate, 0.1mg/mL
BNC881627-100 1x 100 µL

CD79a (B-Cell Marker) (ZL7-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAM2 Rabbit Polyclonal Antibody
HA500440 100 µL

STAM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HECTD2 (NM_182765) Human Over-expression Lysate
LY403656 100 µg

HECTD2 (NM_182765) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DHTKD1 activation kit by CRISPRa
GA110775 1 Kit

Human DHTKD1 activation kit by CRISPRa

Sign In for Pricing
View Details