Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM9 Rabbit Polyclonal Antibody (Biotin)

MCM9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ODG4, MCMDC1, C6orf61, dJ329L24.1, dJ329L24.3

UniProt

B3KV41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MCM9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (MaxLight 550)
MBS6211697-01 0.1 mL

GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (MaxLight 550)

Sign In for Pricing
View Details
GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (MaxLight 550)
MBS6211697-02 5x 0.1 mL

GluR1 (Glutamate Receptor 1, GluR-1, AMPA-selective Glutamate Receptor 1, GLUH1, GLURA, GluR-A, GluR-K1, Glutamate Receptor Ionotropic AMPA 1, GluA1, GRIA1, HBGR1, MGC133252) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Angiopoietin-2 ELISA Kit
MBS2887124-01 48 Well

Mouse Angiopoietin-2 ELISA Kit

Sign In for Pricing
View Details
Mouse Angiopoietin-2 ELISA Kit
MBS2887124-02 96 Well

Mouse Angiopoietin-2 ELISA Kit

Sign In for Pricing
View Details
Mouse Angiopoietin-2 ELISA Kit
MBS2887124-03 5x 96 Well

Mouse Angiopoietin-2 ELISA Kit

Sign In for Pricing
View Details
Mouse Angiopoietin-2 ELISA Kit
MBS2887124-04 10x 96 Well

Mouse Angiopoietin-2 ELISA Kit

Sign In for Pricing
View Details