Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM4 Rabbit Polyclonal Antibody (HRP)

MCM4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NKCD, CDC21, CDC54, IMD54, NKGCD, hCdc21, P1-CDC21

UniProt

P33991

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_877423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP-1 Rabbit Polyclonal Antibody (PE-Cy7)
orb893785 100 µL

MMP-1 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Lentiviral mouse Tars2 shRNA (UAS) - Lentiviral mouse Tars2 shRNA (UAS, GFP) (100)
GTR15272769 1 Vial

Lentiviral mouse Tars2 shRNA (UAS) - Lentiviral mouse Tars2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Corn Steep Powder
LA1070 100 g

Corn Steep Powder

Sign In for Pricing
View Details
Human GORAB qPCR Primer Pair
QH58553S 200 Tests

Human GORAB qPCR Primer Pair

Sign In for Pricing
View Details
Mouse Monoclonal Influenza A H1N1 Hemagglutinin Antibody (9G1G8)
NBP3-23453-100ul 100 µL

Mouse Monoclonal Influenza A H1N1 Hemagglutinin Antibody (9G1G8)

Sign In for Pricing
View Details
Cavy Gamma-Aminobutyric Acid Receptor Subunit Beta-1 (GABRB1) ELISA Kit
MBS9392174 Inquire

Cavy Gamma-Aminobutyric Acid Receptor Subunit Beta-1 (GABRB1) ELISA Kit

Sign In for Pricing
View Details