Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM4 Rabbit Polyclonal Antibody (HRP)

MCM4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NKCD, CDC21, CDC54, IMD54, NKGCD, hCdc21, P1-CDC21

UniProt

P33991

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MCM4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_877423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tau/MAPT Antibody Picoband®, Dylight594 Conjugate
PA1482-Dylight594 100 µg

Anti-Tau/MAPT Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Kv2.2 (KCNB2) (NM_004770) Human Tagged ORF Clone Lentiviral Particle
RC224604L2V 200 µL

Kv2.2 (KCNB2) (NM_004770) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human Chitotriosidase-1/CHIT1 (C-6His)
C451-50ug 50 µg

Recombinant Human Chitotriosidase-1/CHIT1 (C-6His)

Sign In for Pricing
View Details
MYPT1 Peptide
AF7605-BP 1 mg

MYPT1 Peptide

Sign In for Pricing
View Details
Phospho-PI3 Kinase p110 beta (Ser1070) Rabbit pAb Antibody
orb3016727 100 µL

Phospho-PI3 Kinase p110 beta (Ser1070) Rabbit pAb Antibody

Sign In for Pricing
View Details
LOC690806 ORF Vector (Rat) (pORF)
27484016 1.0 µg DNA

LOC690806 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details