Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mcm10 Rabbit Polyclonal Antibody (FITC)

Mcm10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C79164, AU018508, 2410041F14Rik, C330019M07Rik

UniProt

Q0VBD2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fish Homeobox A10 (HOXA10) ELISA Kit
MBS9373557 Inquire

Fish Homeobox A10 (HOXA10) ELISA Kit

Sign In for Pricing
View Details
Chicken Protein Kinase R ELISA Kit
MBS084344 Inquire

Chicken Protein Kinase R ELISA Kit

Sign In for Pricing
View Details
thymocyte selection-associated high mobility group box Recombinant Protein Antigen
NBP1-87857PEP 0.1 mL

thymocyte selection-associated high mobility group box Recombinant Protein Antigen

Sign In for Pricing
View Details
Abra Mouse siRNA Oligo Duplex (Locus ID 223513)
SR412648 1 Kit

Abra Mouse siRNA Oligo Duplex (Locus ID 223513)

Sign In for Pricing
View Details
DMRTC1 (DMRTC1B) Human Gene Knockout Kit (CRISPR)
KN419993 1 Kit

DMRTC1 (DMRTC1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARMER Lentiviral Activation Particles (m)
sc-424820-LAC 200 µL

ARMER Lentiviral Activation Particles (m)

Sign In for Pricing
View Details