Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mcm10 Rabbit Polyclonal Antibody (HRP)

Mcm10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C79164, AU018508, 2410041F14Rik, C330019M07Rik

UniProt

Q0VBD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DEFDELFDADGDGESYTEEAGSGEEGKTGNQEERLATLFGDVEDLTDDEV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain SE11) RUVB Polyclonal Antibody
MBS7172191 Inquire

Rabbit anti-Escherichia coli (strain SE11) RUVB Polyclonal Antibody

Sign In for Pricing
View Details
Rnf31 3'UTR Lenti-reporter-Luc Vector
40306086 1.0 µg

Rnf31 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Lentiviral human ACTA2 sgRNA gene knockout kit - Lentiviral human ACTA2 sgRNA gene knockout kit (25)
GTR15397818 1 Vial

Lentiviral human ACTA2 sgRNA gene knockout kit - Lentiviral human ACTA2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Apom sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6874407 1.0 µg DNA

Apom sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
GLT1D1 Antibody (FITC)
orb35567-01 50 µg

GLT1D1 Antibody (FITC)

Sign In for Pricing
View Details
GLT1D1 Antibody (FITC)
orb35567-02 100 µg

GLT1D1 Antibody (FITC)

Sign In for Pricing
View Details