Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Rabbit Polyclonal Antibody (HRP)

MCM7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3

UniProt

P33993

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005907

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FBF-1
32-10207-500 500 µg

Recombinant Human FBF-1

Sign In for Pricing
View Details
APNG CRISPR Activation Plasmid (h)
sc-404850-ACT 20 µg

APNG CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Smc5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
44432116 3x 1.0 µg

Smc5 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
OLIG3 Human Recombinant Protein
TP725819 50 µg

OLIG3 Human Recombinant Protein

Sign In for Pricing
View Details
Ret (phospho Tyr1062) Polyclonal Antibody
MBS8585772-01 0.1 mg

Ret (phospho Tyr1062) Polyclonal Antibody

Sign In for Pricing
View Details
Ret (phospho Tyr1062) Polyclonal Antibody
MBS8585772-02 0.1 mL (AF405L)

Ret (phospho Tyr1062) Polyclonal Antibody

Sign In for Pricing
View Details