Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Rabbit Polyclonal Antibody (HRP)

MCM7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3

UniProt

P33993

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOLA1 Antibody, Biotin conjugated
CSB-PA002774LD01HU-01 50 µg

BOLA1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
BOLA1 Antibody, Biotin conjugated
CSB-PA002774LD01HU-02 100 µg

BOLA1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human PNPT1 shRNA (UAS) - Lentiviral human PNPT1 shRNA (UAS, GFP) (100)
GTR15113073 1 Vial

Lentiviral human PNPT1 shRNA (UAS) - Lentiviral human PNPT1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-AGRN
orb1133401 100 µL

Anti-AGRN

Sign In for Pricing
View Details
STK11IP Antibody (Center) Blocking Peptide
MBS9223501-01 0.5 mg

STK11IP Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
STK11IP Antibody (Center) Blocking Peptide
MBS9223501-02 5x 0.5 mg

STK11IP Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details