Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Rabbit Polyclonal Antibody (HRP)

MCM7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3

UniProt

P33993

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastClick™ XFD750 Alkyne
72885-AAT 1 mg

FastClick™ XFD750 Alkyne

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1672), Biotin conjugate, 0.1mg/mL
BNCB1672-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (ANXA1/1672), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Borrelia burgdorferi (p41 Flagellin) (6802), CF594 conjugate, 0.1mg/mL
BNC940144-100 1x 100 µL

Borrelia burgdorferi (p41 Flagellin) (6802), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-ROX, SE [5-Carboxy-X-rhodamine, succinimidyl ester] *CAS 209734-74-7*
389-AAT 5 mg

5-ROX, SE [5-Carboxy-X-rhodamine, succinimidyl ester] *CAS 209734-74-7*

Sign In for Pricing
View Details
IFluor® 568 maleimide
1055-AAT 1 mg

IFluor® 568 maleimide

Sign In for Pricing
View Details
CD44 / HCAM Std. (BU75), CF640R conjugate, 0.1mg/mL
BNC401616-100 1x 100 µL

CD44 / HCAM Std. (BU75), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details