Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Rabbit Polyclonal Antibody (Biotin)

MCM7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3

UniProt

P33993

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MCM7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuritin (NRN1) Mouse ELISA Kit
F3217 96 Tests

Neuritin (NRN1) Mouse ELISA Kit

Sign In for Pricing
View Details
Compound NP-024359
T128070-01 10 mg

Compound NP-024359

Sign In for Pricing
View Details
Compound NP-024359
T128070-02 1 g

Compound NP-024359

Sign In for Pricing
View Details
Compound NP-024359
T128070-03 1 mg

Compound NP-024359

Sign In for Pricing
View Details
Compound NP-024359
T128070-04 50 mg

Compound NP-024359

Sign In for Pricing
View Details
Compound NP-024359
T128070-05 5 mg

Compound NP-024359

Sign In for Pricing
View Details