Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF1 Rabbit Polyclonal Antibody (HRP)

CRLF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLF, NR6, CISS, CISS1, CLF-1, zcytor5

UniProt

O75462

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG4A (369-398) Rabbit Polyclonal Antibody
AP32201PU-N 400 µL

ATG4A (369-398) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bak (BAK1) (NM_001188) Human Over-expression Lysate
LC400476 20 µg

Bak (BAK1) (NM_001188) Human Over-expression Lysate

Sign In for Pricing
View Details
Human GAL3 (Galectin 3) CLIA Kit
E-CL-H0948-01 24 Tests

Human GAL3 (Galectin 3) CLIA Kit

Sign In for Pricing
View Details
Human GAL3 (Galectin 3) CLIA Kit
E-CL-H0948-02 48 Tests

Human GAL3 (Galectin 3) CLIA Kit

Sign In for Pricing
View Details
Human GAL3 (Galectin 3) CLIA Kit
E-CL-H0948-03 96 Tests

Human GAL3 (Galectin 3) CLIA Kit

Sign In for Pricing
View Details
P4HA3 Human Gene Knockout Kit (CRISPR)
KN424487 1 Kit

P4HA3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details