Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLF1 Rabbit Polyclonal Antibody (FITC)

CRLF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CLF, NR6, CISS, CISS1, CLF-1, zcytor5

UniProt

O75462

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRLF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti 2019-nCoV Spike Protein hIgG Antibody
MBS515765-01 0.02 mg

Anti 2019-nCoV Spike Protein hIgG Antibody

Sign In for Pricing
View Details
Anti 2019-nCoV Spike Protein hIgG Antibody
MBS515765-02 0.1 mg

Anti 2019-nCoV Spike Protein hIgG Antibody

Sign In for Pricing
View Details
Anti 2019-nCoV Spike Protein hIgG Antibody
MBS515765-03 5x 0.1 mg

Anti 2019-nCoV Spike Protein hIgG Antibody

Sign In for Pricing
View Details
Arv1 (NM_001106197) Rat Tagged Lenti ORF Clone
RR203641L3 10 µg

Arv1 (NM_001106197) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
T/ADR9A-LBM/NT/PE/297X297/1 Parking, Traffic & Road Signs & Labels (Adhesive)
198521 1 Pack (1 Panel (s) x 1 Pack)

T/ADR9A-LBM/NT/PE/297X297/1 Parking, Traffic & Road Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Mouse anti-CD68 Recombinant Monoclonal Antibody, Purified [KP-1]
MBS3906055-01 0.1 mg

Mouse anti-CD68 Recombinant Monoclonal Antibody, Purified [KP-1]

Sign In for Pricing
View Details