Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX2 Rabbit Polyclonal Antibody (HRP)

RUNX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CCD, AML3, CCD1, CLCD, OSF2, CBFA1, OSF-2, PEA2aA, PEBP2aA, CBF-alpha-1

UniProt

Q13950

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RUNX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001019801

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-LO (phospho Ser523) Polyclonal Antibody
RA21506-01 50 µL

5-LO (phospho Ser523) Polyclonal Antibody

Sign In for Pricing
View Details
5-LO (phospho Ser523) Polyclonal Antibody
RA21506-02 100 µL

5-LO (phospho Ser523) Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Pitrm1 qPCR Primer Pair
QM37834S 200 Tests

Mouse Pitrm1 qPCR Primer Pair

Sign In for Pricing
View Details
RTDR1 Protein Vector (Rat) (pPM-C-HA)
PV302948 500 ng

RTDR1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rcor2 Rabbit Polyclonal Antibody (FITC)
orb2134573 100 µL

Rcor2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
RBPJP6 3'UTR GFP Stable Cell Line
TU069679 1.0 mL

RBPJP6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details