Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX36 Rabbit Polyclonal Antibody (FITC)

CX36 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CX36, GJA9

UniProt

Q9UKL4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CX36

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC4 (Mucin 4 / Gastric Mucin) (MUC4/3105), CF405S conjugate, 0.1mg/mL
BNC043105-100 1x 100 µL

MUC4 (Mucin 4 / Gastric Mucin) (MUC4/3105), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF-alpha (Tumor Necrosis Factor alpha), Biotin conjugate, 0.1mg/mL
BNCB1674-500 1x 500 µL

TNF-alpha (Tumor Necrosis Factor alpha), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ɑ-Butyric Acid NHS Ester-ω-Maleimidohexanamido PEG
133000-65-35.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Maleimidohexanamido PEG

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r6E1), 0.2mg/mL
BNUB1969-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), 0.2mg/mL

Sign In for Pricing
View Details
Human AQP-3 (Aquaporin 3) ELISA Kit
E-EL-H0489-01 24 Tests

Human AQP-3 (Aquaporin 3) ELISA Kit

Sign In for Pricing
View Details
Human AQP-3 (Aquaporin 3) ELISA Kit
E-EL-H0489-02 48 Tests

Human AQP-3 (Aquaporin 3) ELISA Kit

Sign In for Pricing
View Details