Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX36 Rabbit Polyclonal Antibody (FITC)

CX36 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CX36, GJA9

UniProt

Q9UKL4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CX36

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTR1B Rabbit Polyclonal Antibody
TA373235 100 µL

ACTR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR560309 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800143 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
ARHGDIG (NM_001176) Human Over-expression Lysate
LY420085 100 µg

ARHGDIG (NM_001176) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS704031 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
HPCAL4 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF808681 100 µg

HPCAL4 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details