Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CX36 Rabbit Polyclonal Antibody (HRP)

CX36 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CX36, GJA9

UniProt

Q9UKL4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CX36

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065711

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CXCL2/MIP-2, Tag Free
HA211132-01 20 µg

Rat CXCL2/MIP-2, Tag Free

Sign In for Pricing
View Details
Rat CXCL2/MIP-2, Tag Free
HA211132-02 50 µg

Rat CXCL2/MIP-2, Tag Free

Sign In for Pricing
View Details
Rat CXCL2/MIP-2, Tag Free
HA211132-03 100 µg

Rat CXCL2/MIP-2, Tag Free

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8/803), CF568 conjugate, 0.1mg/mL
BNC680803-100 1x 100 µL

Cytokeratin 8 (KRT8/803), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Taar7f Mouse Gene Knockout Kit (CRISPR)
KN517112 1 Kit

Taar7f Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LOC644090 activation kit by CRISPRa
GA118723 1 Kit

Human LOC644090 activation kit by CRISPRa

Sign In for Pricing
View Details