Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA10 Rabbit Polyclonal Antibody (HRP)

ANXA10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ANX14

UniProt

Q9UJ72

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ANXA10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLWEACQQKTGEHKTMLQMILCNKSYQQLRLVFQEFQNISGQDMVDAINE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_009124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdhr4 Mouse siRNA Oligo Duplex (Locus ID 69398)
SR407692 1 Kit

Cdhr4 Mouse siRNA Oligo Duplex (Locus ID 69398)

Sign In for Pricing
View Details
Olfr1308 Protein Vector (Mouse) (pPB-N-His)
PV208915 500 ng

Olfr1308 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
MEKK3 (MAPK/ERK Kinase Kinase 3, MEK Kinase 3, MEKK 3, Mitogen-activated Protein Kinase Kinase Kinase 3, MAP3K3, MAPKKK3)
129571 100 µg

MEKK3 (MAPK/ERK Kinase Kinase 3, MEK Kinase 3, MEKK 3, Mitogen-activated Protein Kinase Kinase Kinase 3, MAP3K3, MAPKKK3)

Sign In for Pricing
View Details
Mouse Monoclonal Endophilin B1/Bif-1 Antibody (30A882.1.1) [HRP]
NBP2-24733H 0.1 mL

Mouse Monoclonal Endophilin B1/Bif-1 Antibody (30A882.1.1) [HRP]

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae lpxK Protein (aa 1-332)
VAng-Lsx03475-1mgEcoli 1 mg (E. coli)

Recombinant Haemophilus Influenzae lpxK Protein (aa 1-332)

Sign In for Pricing
View Details
Anti-HE4 Antibody, Rabbit Polyclonal
MBS8106554-01 0.1 mL

Anti-HE4 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details