Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Rabbit Polyclonal Antibody (FITC)

MCM7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3

UniProt

P33993

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MCM7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_877577

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rac N-Benzyl Nebivolol
003620 2 mg

Rac N-Benzyl Nebivolol

Sign In for Pricing
View Details
ZNF211 (NM_006385) Human Tagged ORF Clone
RG213336 10 µg

ZNF211 (NM_006385) Human Tagged ORF Clone

Sign In for Pricing
View Details
LENEP protein
30R-3157 0.1 mg

LENEP protein

Sign In for Pricing
View Details
GINS2, ID (GINS2, PSF2, DNA replication complex GINS protein PSF2, GINS complex subunit 2) (PE)
MBS6302280-01 0.2 mL

GINS2, ID (GINS2, PSF2, DNA replication complex GINS protein PSF2, GINS complex subunit 2) (PE)

Sign In for Pricing
View Details
GINS2, ID (GINS2, PSF2, DNA replication complex GINS protein PSF2, GINS complex subunit 2) (PE)
MBS6302280-02 5x 0.2 mL

GINS2, ID (GINS2, PSF2, DNA replication complex GINS protein PSF2, GINS complex subunit 2) (PE)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) DAPB Polyclonal Antibody
MBS7176561 Inquire

Rabbit anti-Escherichia coli O7:K1 (strain IAI39/ExPEC) DAPB Polyclonal Antibody

Sign In for Pricing
View Details