Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD11 Rabbit Polyclonal Antibody (HRP)

KCTD11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

REN, KCASH1, C17orf36, REN/KCTD11

UniProt

Q693B1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_001002914

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COUP Transcription Factor 2 (NR2F2) Rat ELISA Kit
C5999 96 Tests

COUP Transcription Factor 2 (NR2F2) Rat ELISA Kit

Sign In for Pricing
View Details
MIR4711 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV770043 1.0 µg DNA

MIR4711 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Cryba4 sgRNA CRISPR Lentivector set (Mouse)
K3392201 3x 1.0 µg

Cryba4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal Glutamine Synthetase Antibody
NBP1-89767 0.1 mL

Rabbit Polyclonal Glutamine Synthetase Antibody

Sign In for Pricing
View Details
Rpl3l Mouse shRNA Plasmid (Locus ID 66211)
TL503553 1 Kit

Rpl3l Mouse shRNA Plasmid (Locus ID 66211)

Sign In for Pricing
View Details
TSSK6 (Testis-specific Serine/threonine-protein Kinase 6, TSSK-6, Testis-specific Kinase 6, TSK-6, Cancer/testis Antigen 72, CT72, FKSG82, Serine/threonine-protein Kinase SSTK, Small Serine/threonine Kinase, SSTK) (MaxLight 650)
134842-ML650 100 µL

TSSK6 (Testis-specific Serine/threonine-protein Kinase 6, TSSK-6, Testis-specific Kinase 6, TSK-6, Cancer/testis Antigen 72, CT72, FKSG82, Serine/threonine-protein Kinase SSTK, Small Serine/threonine Kinase, SSTK) (MaxLight 650)

Sign In for Pricing
View Details