Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Rabbit Polyclonal Antibody (HRP)

Prrxl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Drg11, Prrxl1

UniProt

Q62798

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Prrxl1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAKEPMAEVTPPPVRNINSPPPGDQARGKKEALEAQQSLGRTVGPAGPFF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_665710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YY1 (Yin and Yang 1, YY-1, Transcriptional Repressor Protein YY1, Delta Transcription Factor, INO80 Complex Subunit S, INO80S, NF-E1)
135492 100 µg

YY1 (Yin and Yang 1, YY-1, Transcriptional Repressor Protein YY1, Delta Transcription Factor, INO80 Complex Subunit S, INO80S, NF-E1)

Sign In for Pricing
View Details
Mouse Monoclonal Glutamine Synthetase Antibody (rGLUL/8620) [mFluor Violet 610 SE]
NBP3-24262MFV610 0.1 mL

Mouse Monoclonal Glutamine Synthetase Antibody (rGLUL/8620) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
CD99, Recombinant, Human (MIC2, p30/32MIC2, Ewing’s Sarcoma Marker, E2 Antigen) discontinued
C2444-14-01 2 µg

CD99, Recombinant, Human (MIC2, p30/32MIC2, Ewing’s Sarcoma Marker, E2 Antigen) discontinued

Sign In for Pricing
View Details
CD99, Recombinant, Human (MIC2, p30/32MIC2, Ewing’s Sarcoma Marker, E2 Antigen) discontinued
C2444-14-02 5 µg

CD99, Recombinant, Human (MIC2, p30/32MIC2, Ewing’s Sarcoma Marker, E2 Antigen) discontinued

Sign In for Pricing
View Details
DNAJB6 (NM_005494) Human Tagged Lenti ORF Clone
RC201620L4 10 µg

DNAJB6 (NM_005494) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LHX6 siRNA (m)
sc-75426 10 µM

LHX6 siRNA (m)

Sign In for Pricing
View Details