Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Rabbit Polyclonal Antibody (HRP)

Prrxl1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Drg11, Prrxl1

UniProt

Q62798

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prrxl1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFALQQLEALEA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_665710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP6 Mouse Monoclonal Antibody [Clone ID: LBI5G2]
AMM14479V 100 µL

THAP6 Mouse Monoclonal Antibody [Clone ID: LBI5G2]

Sign In for Pricing
View Details
SEMA4B/Semaphorin 4B Antibody
orb1534743 50 µg

SEMA4B/Semaphorin 4B Antibody

Sign In for Pricing
View Details
Mia1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4912004 1.0 µg DNA

Mia1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Horse Endocrine Gland Vascular Endothelial Growth Factor ELISA Kit
MBS025040-01 48 Well

Horse Endocrine Gland Vascular Endothelial Growth Factor ELISA Kit

Sign In for Pricing
View Details
Horse Endocrine Gland Vascular Endothelial Growth Factor ELISA Kit
MBS025040-02 96 Well

Horse Endocrine Gland Vascular Endothelial Growth Factor ELISA Kit

Sign In for Pricing
View Details
Horse Endocrine Gland Vascular Endothelial Growth Factor ELISA Kit
MBS025040-03 5x 96 Well

Horse Endocrine Gland Vascular Endothelial Growth Factor ELISA Kit

Sign In for Pricing
View Details