Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrxl1 Rabbit Polyclonal Antibody (Biotin)

Prrxl1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Drg11, Prrxl1

UniProt

Q62798

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prrxl1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MFYFHCPPQLEGTAPFGNHSTGDFDDGFLRRKQRRNRTTFALQQLEALEA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_665710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A Rabbit pAb
APA2139-01 30 µL

Chromogranin A Rabbit pAb

Sign In for Pricing
View Details
Chromogranin A Rabbit pAb
APA2139-02 50 μL

Chromogranin A Rabbit pAb

Sign In for Pricing
View Details
Chromogranin A Rabbit pAb
APA2139-03 100 µL

Chromogranin A Rabbit pAb

Sign In for Pricing
View Details
Human cross linked N-telopeptide of typeⅠcollagen (NTX) ELISA Kit
GA-E1400HM-01 48 Tests

Human cross linked N-telopeptide of typeⅠcollagen (NTX) ELISA Kit

Sign In for Pricing
View Details
Human cross linked N-telopeptide of typeⅠcollagen (NTX) ELISA Kit
GA-E1400HM-02 96 Tests

Human cross linked N-telopeptide of typeⅠcollagen (NTX) ELISA Kit

Sign In for Pricing
View Details
Human Thymosin beta-4 (TMSB4X) ELISA Kit
RK12397 96 Tests

Human Thymosin beta-4 (TMSB4X) ELISA Kit

Sign In for Pricing
View Details