Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rhox8 Rabbit Polyclonal Antibody (HRP)

Rhox8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

To, Tox

UniProt

Q6VSS7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rhox8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001004193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIBAN1 Rabbit Polyclonal Antibody
AP02798PU-S 50 µL

NIBAN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Mrps16 activation kit by CRISPRa
GA206658 1 Kit

Mouse Mrps16 activation kit by CRISPRa

Sign In for Pricing
View Details
HDAC1 Human Gene Knockout Kit (CRISPR)
KN201745BN 1 Kit

HDAC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI1C8]
CF805966 100 µg

FSIP1 Mouse Monoclonal Antibody [Clone ID: OTI1C8]

Sign In for Pricing
View Details
NMU Rabbit Polyclonal Antibody
AP21204PU-N 100 µg

NMU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3193), CF647 conjugate, 0.1mg/mL
BNC473193-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3193), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details