Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noto Rabbit Polyclonal Antibody (HRP)

Noto Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N, Fl, tc, Flh, MmN, Not, MmNot

UniProt

A8MTQ0

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Noto

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007473

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Cholinergic Receptor, Nicotinic, Alpha 3 (CHRNA3)
FY-AB49720-01 1 mL

Anti-Cholinergic Receptor, Nicotinic, Alpha 3 (CHRNA3)

Sign In for Pricing
View Details
Anti-Cholinergic Receptor, Nicotinic, Alpha 3 (CHRNA3)
FY-AB49720-02 100 µL

Anti-Cholinergic Receptor, Nicotinic, Alpha 3 (CHRNA3)

Sign In for Pricing
View Details
Anti-Cholinergic Receptor, Nicotinic, Alpha 3 (CHRNA3)
FY-AB49720-03 200 µL

Anti-Cholinergic Receptor, Nicotinic, Alpha 3 (CHRNA3)

Sign In for Pricing
View Details
LINC00523 Human shRNA Plasmid Kit (Locus ID 283601)
TL314380 1 Kit

LINC00523 Human shRNA Plasmid Kit (Locus ID 283601)

Sign In for Pricing
View Details
Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody
TA319755 100 µg

Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Tmed11 shRNA (UAS) - Lentiviral mouse Tmed11 shRNA (UAS, RFP) plasmid
GTR15266617 1 Vial

Lentiviral mouse Tmed11 shRNA (UAS) - Lentiviral mouse Tmed11 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details