Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxi1 Rabbit Polyclonal Antibody (Biotin)

Mxi1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mad2, Gm10197, bHLHc11

UniProt

Q3U3X2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mxi1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEARCEGAGLVPVAPPAMPPAAAAPQPPAQPEEPAGAKPRCPFSDIFNTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001008542

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf72 Protein Vector (Human) (pPB-N-His)
PV049602 500 ng

C16orf72 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human UQCRQ shRNA (UAS) - Lentiviral human UQCRQ shRNA (UAS, RFP) (100)
GTR15140388 1 Vial

Lentiviral human UQCRQ shRNA (UAS) - Lentiviral human UQCRQ shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Mouse STEAP family member 4, Steap4 ELISA Kit
MBS1601038-01 48 Well

Mouse STEAP family member 4, Steap4 ELISA Kit

Sign In for Pricing
View Details
Mouse STEAP family member 4, Steap4 ELISA Kit
MBS1601038-02 96 Well

Mouse STEAP family member 4, Steap4 ELISA Kit

Sign In for Pricing
View Details
Mouse STEAP family member 4, Steap4 ELISA Kit
MBS1601038-03 5x 96 Well

Mouse STEAP family member 4, Steap4 ELISA Kit

Sign In for Pricing
View Details
Mouse STEAP family member 4, Steap4 ELISA Kit
MBS1601038-04 10x 96 Well

Mouse STEAP family member 4, Steap4 ELISA Kit

Sign In for Pricing
View Details